CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 4.33OZ. Benefits: Strengthens, visibly repairs lines and wrinkles, hydrates. A powerful addition to Clinique's most advanced de-aging line yet, Clinique Smart Clinical Repair, this ultra-nourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple, younger-looking skin.. Cutting-edge formula with CL1870 Peptide Complex helps boost skin's natural collagen to help fortify the dermal structure, leaving skin feeling stronger and looking smoother.. Moisturizer plumps skin with lasting hydration.. Available in two textures: Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe, denser cream for those with drier skin.. Built on Dermatological Science: As a dermatologist-guided brand, Clinique's commitment to safety starts with skincare science. Clinique partners with the best minds in dermatology and formulate for all skin types, tones, concerns - in service of all skin.. Fragrance-free, Paraben-free, Phthalate-free, Oil-free, Free of synthetic colors.. More Responsible Packaging:. 50ml and 15ml jars each contain a minimum of 30% post-consumer recycled content.. Carton is made from responsibly sourced paperboard. Please recycle.. Key Ingredients: Formulated with peptides to help boost skin's strength for a smoother appearance and hyaluronic acid to help hydrate skin.. CL1870 Peptide Complex: An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen, which helps strengthen skin's natural support structure.. Hyaluronic acid: Exclusive formula uses two molecular weights of hyaluronic acid. This intense humectant helps flood your skin with hydration -and holds on. Helps restore suppleness and visibly smooth fine, dry lines.. Soybean seed extract: An ingredient rich in lysophosphatidic acid (LPA), which nourishes to help fortify skin.. Shea butter: Found in the Rich Cream, it contains lipids that form skin's barrier and is integral to keeping drier skin hydrated.. :
CLINIQUE Smart Clinical Repair Wrinkle Correcting Rich Face Cream
Compare Across 800+ Stores

Smart Clinical Repair Wrinkle Correcting Rich Face Cream
CLMRTCLCLRPRWRKLCRCTGCRMVRYDRYTDR 4.33OZ. Benefits: Strengthens, visibly repairs lines and wrinkles, hydrates. A powerful addition to Clinique's most advanced de-aging line yet, Clinique Smart Clinical Repair, this ultra-nourishing moisturizer is engineered to visibly reduce lines and wrinkles for supple, younger-looking skin.. Cutting-edge formula with CL1870 Peptide Complex helps boost skin's natural collagen to help fortify the dermal structure, leaving skin feeling stronger and looking smoother.. Moisturizer plumps skin with lasting hydration.. Available in two textures: Wrinkle Correcting Cream is a lightweight cream for All Skin Types and Wrinkle Correcting Rich Cream is a luxe, denser cream for those with drier skin.. Built on Dermatological Science: As a dermatologist-guided brand, Clinique's commitment to safety starts with skincare science. Clinique partners with the best minds in dermatology and formulate for all skin types, tones, concerns - in service of all skin.. Fragrance-free, Paraben-free, Phthalate-free, Oil-free, Free of synthetic colors.. More Responsible Packaging:. 50ml and 15ml jars each contain a minimum of 30% post-consumer recycled content.. Carton is made from responsibly sourced paperboard. Please recycle.. Key Ingredients: Formulated with peptides to help boost skin's strength for a smoother appearance and hyaluronic acid to help hydrate skin.. CL1870 Peptide Complex: An expert peptide blend engineered to fight the look of wrinkles by boosting natural collagen, which helps strengthen skin's natural support structure.. Hyaluronic acid: Exclusive formula uses two molecular weights of hyaluronic acid. This intense humectant helps flood your skin with hydration -and holds on. Helps restore suppleness and visibly smooth fine, dry lines.. Soybean seed extract: An ingredient rich in lysophosphatidic acid (LPA), which nourishes to help fortify skin.. Shea butter: Found in the Rich Cream, it contains lipids that form skin's barrier and is integral to keeping drier skin hydrated.. :